Protein Summary

Dcp2 from Schizosaccharomyces pombe

Full name: RNA decapping complex subunit 2
Synonym:
GI: 74675930
Orf: dcp2
COG: COG0494
UniProt: O13828
Structures: | 2A6T |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

The Dcp2 protein removes the cap structure of mRNA by cleaving capped mRNA which allows initiating 5′ to 3′ degradation. Decapping holoenzyme is composed of the catalytic Dcp2 subunit and the coactivator Dcp1. Dcp1 and the substrate RNA promote the closed form of the enzyme and the catalytic step of decapping is rate limiting and accelerated by Dcp1.

Protein sequence:

MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIR
AQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRG
AIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGF
DCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHN
LMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISV
DVDADASSQLLSLLKSSTAPSDLATPQPSTFPQPPVESHSSFDIKQKILH
LLNEGNEPKSPIQLPPVSNLPLNPPIQSSNSRLSHDNNSFDPFAYLGLDP
KNPSASFPRVVSQNNMLTNKPVLNNHFQQSMYSNLLKDQNSVQHLFAASD
MPSPMELPSPSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQ
TQQISSLPPFQSQTQFLARNSDNSGQSYNSEGDSNSKRLLSMLSQQDTTP
SSSTLSKEANVQLANLFLTPNSLETKKFSDNSQGEEISDNLHGESCNNPN
ANSVHSAQLLQALLHPSATETKEETPKKTSDSLSLLTLLKSGLPTPANDL
QNKSQNNERKASSQVKELEVKNYSKSTDLLKKTLRIPRNDEPLEAANQFD
LLKVSPQQKSEVPPKRNELSQSKLKNRKKKENSETNKNHVDMSPGFVKIL
KRSPLADQKKEDTQESDFKGSDDHFLSYLQSVVSSNSNGLH

Publications

Title Authors Journal Details PubMed Id DOI
Decapping reaction of mRNA requires Dcp1 in fission yeast: its characterization in different species from yeast to human. Sakuno T, Araki Y, Ohya Y, Kofuji S, Takahashi S, Hoshino S, Katada T... J Biochem [details] 15671491 -

Links

_PubMed_

Last modification of this entry: 2012-08-24 16:02:24.008534
Edited by a user: magda
Edited content: Changed papers.