Protein Summary

Tgs1 from Homo sapiens

Full name: trimethylguanosinesynthase 1
Synonym: PRIP-interacting protein with methyltransferase motif (PIMT)
GI: 317373500
Orf: TGS1
COG: COG2263
UniProt: Q96RS0
Structures: | 3EGI | 3GDH |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: n:0 - m2,2,7Gpp(pN)
snoRNA:0 - m2,2,7Gpp(pN)

Comments:

Catalyzes the two sequential methylation steps for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Some selenoprotein mRNAs were found to contain 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure and Tgs1 was found to be involved in hypermethylation of these caps.

Protein sequence:

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRD
SGNNSGDQATEEEEGGYSCGTAESHDSKGIGLDESELDSEAELMRSMGLP
LQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQESWRKEYEEDD
ILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEK
YWNEYGGGLLWQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLE
QFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPI
MVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSE
VSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKD
RPHASGTDGDESEEDPPEHKPSKLKRSHELDIDENPASDFDDSGSLLGFK
YGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKMKNKHIFFTKE
SEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSE
EQDMSVKKGDDLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQ
DCVTQEVPDSRQAETEAEVKKKKNKKKNKKVNGLPPEIAAVPELAKYWAQ
RYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCG
VGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLL
LASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNN
IVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPA
SET

Enzymatic activities

Reaction Substrate Type Position
m7Gpp(pN):m2,7Gpp(pN) snRNA (sn) U1 0
m7Gpp(pN):m2,7Gpp(pN) snRNA (sn) U2// 0
m7Gpp(pN):m2,7Gpp(pN) snRNA (sn) U4// 0
m7Gpp(pN):m2,7Gpp(pN) snoRNA (sno) U3//nucleoplasmic 0
m7Gpp(pN):m2,7Gpp(pN) snoRNA (sno) snR10//nucleoplasmic 0
m7Gpp(pN):m2,7Gpp(pN) snoRNA (sno) snR30//nucleoplasmic 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snRNA (sn) U1 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snRNA (sn) U2// 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snRNA (sn) U4// 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snoRNA (sno) U3//nucleoplasmic 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snoRNA (sno) snR10//nucleoplasmic 0
m2,7Gpp(pN):m2,2,7Gpp(pN) snoRNA (sno) snR30//nucleoplasmic 0

Publications

Title Authors Journal Details PubMed Id DOI
Genetic and biochemical analysis of yeast and human cap trimethylguanosine synthase: functional overlap of 2,2,7-trimethylguanosine caps, small nuclear ribonucleoprotein components, pre-mRNA splicing factors, and RNA decay pathways. Hausmann S, Zheng S, Costanzo M, Brost RL, Garcin D, Boone C, Shuman S, Schwer B J Biol Chem [details] 18775984 -
Structure analysis of the conserved methyltransferase domain of human trimethylguanosine synthase TGS1. Monecke T, Dickmanns A, Strasser A, Ficner R Acta Crystallogr D Biol Crystallogr [details] 19307714 -
Hypermethylated-capped selenoprotein mRNAs in mammals. Wurth L, Gribling-Burrer AS, Verheggen C, Leichter M, Takeuchi A, Baudrey S, Martin F, Krol A, Bertrand E, Allmang C... Nucleic Acids Res [details] 25013170 -

Last modification of this entry: 2014-12-23 17:37:01.248802
Edited by a user: magda
Edited content: Changed comments.