Protein Summary

HCAP1 from Homo sapiens

Full name: RNA-capping enzyme
Synonym: HCE, mRNA 5'-triphosphatase, GTP--RNA guanylyltransferase
GI: 6685628
Orf: RNGTT
COG: COG5226
UniProt: O60942
Structures: | 3S24 |
Complex:
Enzyme type: triphosphatase, guanylyltransferase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part.

Protein sequence:

MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSML
SNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTT
ENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIE
AAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE
DEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKL
GEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGL
IDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP
GRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQ
IKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSIS
NPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT

Enzymatic activities

Reaction Substrate Type Position
pp(pN):p(pN) mRNA (m) 0
p(pN):Gpp(pN) mRNA (m) 0

Publications

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme. Yamada-Okabe T, Doi R, Shimmi O, Arisawa M, Yamada-Okabe H Nucleic Acids Res [details] 9512541 -
Cloning and characterization of two human cDNAs encoding the mRNA capping enzyme. Tsukamoto T, Shibagaki Y, Murakoshi T, Suzuki M, Nakamura A, Gotoh H, Mizumoto K Biochem Biophys Res Commun [details] 9473487 -
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ J Biol Chem [details] 9705270 -
Structure of the guanylyltransferase domain of human mRNA capping enzyme. Chu C, Das K, Tyminski JR, Bauman JD, Guan R, Qiu W, Montelione GT, Arnold E, Shatkin AJ Proc Natl Acad Sci U S A [details] 21636784 -

Links

_Wikipedia_

Last modification of this entry: 2012-11-30 11:39:52.621707
Edited by a user: magda
Edited content: Changed protein_sequence and additional_information.