Protein Summary

TrmB from Bacillus subtilis

Full name: tRNA (guanine-N(7)-)-methyltransferase
Synonym: ytmQ
GI: 14194920
Orf:
COG: COG0220
UniProt: O34522
Structures: | 2FCA |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

AdoMet is the methyl group donor. The activity was tested in vitro on tRNAPhe transctipt.

Protein sequence:

MRMRHKPWADDFLAENADIAISNPADYKGKWNTVFGNDNPIHIEVGTGKG
QFISGMAKQNPDINYIGIELFKSVIVTAVQKVKDSEAQNVKLLNIDADTL
TDVFEPGEVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKGGSIH
FKTDNRGLFEYSLKSFSEYGLLLTYVSLDLHNSNLEGNIMTEYEEKFSAL
GQPIYRAEVEWRT

Enzymatic activities

Reaction Substrate Type Position
G:m7G tRNA (t) Phe/#AA/prokaryotic cytosol 46

Publications

Title Authors Journal Details PubMed Id DOI
Crystal structure of Bacillus subtilis TrmB, the tRNA (m7G46) methyltransferase. Zegers I, Gigot D, van Vliet F, Tricot C, Aymerich S, Bujnicki JM, Kosinski J, Droogmans L Nucleic Acids Res [details] 16600901 -

Links

_PubMed_

Last modification of this entry: Feb. 4, 2014