Protein Summary

Trm140 from Saccharomyces cerevisiae

Full name: 140 kDa actin-binding protein
Synonym: Abp140
GI: 398365899
Orf:
COG: COG2226
UniProt: Q08641
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:32 - m3C

Comments:

Primer extension experiment shown that this enzyme is responsible for m3C modification in position 32 in all Ser and Thr tRNAs. The activity was tested in vitro on tRNAThrIGU. AdoMet is the methyl group donor.

Protein sequence:

MGVADLIKKFESISKEEGDATVDTNSSSKPLKSNDETKELHQQESTAVPQ
EVDVNEEFENEPETINSSRTAEKPLETNLPKPETNEEDEEEGSMSENKIY
SKGENADINVNDFQEYKEMENTGAEVLASSVEESDAIQEGVAEETEGIAT
PKQKENEKNDESEEESANNASEPAEEYSQSEEDADIEQSNGKETENAENA
SQQANDGSTSTTTSKNKKKKNKKKNKKKRNGNVNTNANVDDSTKTGENDD
TTGDTTSSTTSAIQEVNDLEVVDDSCLGIDQQHNREHLKALTQDVKEETL
ENIAHEGRGDNTGDQNAVEKSDFEKSDTEGSRIGRDLPFEFGKRNLTEES
DVWDHNAWDNVEWGEEQVQQAEEKIKEQFKHPVPEFDKKLYNENPARYWD
IFYKNNKENFFKDRKWLQIEFPILYASTRKDAEPVTIFEIGCGAGNTFFP
ILKDNENENLRIIAADFAPRAVELVKNSEQFNPKYGHATVWDLANPDGNL
PDGVEPHSVDIAVMIFVFSALAPNQWDQAMDNLHKILKPGGKIIFRDYGA
YDLTQVRFKKNRILEENFYVRGDGTRVYFFSEEKLREIFTKKYFLENKIG
TDRRLLVNRKRQLKMYRCWVQAVFDVPQ

Enzymatic activities

Reaction Substrate Type Position
C:m3C tRNA (t) Thr/IGU/cytosolic 32
C:m3C tRNA (t) Ser/IGA/cytosolic 32

Publications

Title Authors Journal Details PubMed Id DOI
Actin-binding protein ABP140 is a methyltransferase for 3-methylcytidine at position 32 of tRNAs in Saccharomyces cerevisiae. Noma A, Yi S, Katoh T, Takai Y, Suzuki T, Suzuki T RNA [details] 21518805 -
A domain of the actin binding protein Abp140 is the yeast methyltransferase responsible for 3-methylcytidine modification in the tRNA anti-codon loop. D'Silva S, Haider SJ, Phizicky EM RNA [details] 21518804 -

Links

_PubMed_
_SGD_

Last modification of this entry: Feb. 4, 2014