Protein Summary

Trmt61A from Homo sapiens

Full name: tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
Synonym: C14orf172, TRM61
GI: 123173772
Orf:
COG: COG2519
UniProt: Q96FX7
Structures: | 5CCB | 5CD1 | 5CCX |
Complex: Trm6/Trm61
Enzyme type: methyltransferase
Position of modification - modification: t:58 - m1A

Comments:

A part of heterodimeric Trm6/Trm61 MTase. The activity tested on yeast tRNAs in vitro (tRNAi Met) and on htRNA3Lys expressed in yeast cells in vivo. Paralog of mitochondrial Trm61B.

Protein sequence:

MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI
GRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLE
LRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQE
HRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEG
GRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDL
GTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG

Enzymatic activities

Reaction Substrate Type Position
A:m1A tRNA (t) Lys/unknown/cytosolic 58

Publications

Title Authors Journal Details PubMed Id DOI
The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans. Ozanick S, Krecic A, Andersland J, Anderson JT RNA [details] 16043508 -
Crystal Structure of the Human tRNA mA58 Methyltransferase-tRNA Complex: Refolding of Substrate tRNA allows Access to the Methylation Target. Finer-Moore J, Czudnochowski N, O'Connell JD 3rd, Wang AL, Stroud RM... J Mol Biol [details] 26470919 -

Last modification of this entry: 2017-09-14 16:50:25.866073
Edited by a user: elapurta
Edited content: No fields changed.