Protein Summary

QueF from Bacillus subtilis

Full name: NADPH-dependent 7-cyano-7-deazaguanine reductase
Synonym: ykvM, BSU13750
GI: 81555909
Orf:
COG: COG0780
UniProt: O31678
Structures: | 4F8B | 4FGC |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:34 - QtRNA

Comments:



Protein sequence:

MTTRKESELEGVTLLGNQGTNYLFEYAPDVLESFPNKHVNRDYFVKFNCP
EFTSLCPKTGQPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHEDC
MNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEY
RMMNHDLYPETIDNR

Enzymatic activities

Reaction Substrate Type Position
preQ0base:preQ1base    

Publications

Title Authors Journal Details PubMed Id DOI
Crystallization and preliminary X-ray characterization of the nitrile reductase QueF: a queuosine-biosynthesis enzyme. Swairjo MA, Reddy RR, Lee B, Van Lanen SG, Brown S, de Crecy-Lagard V, Iwata-Reuyl D, Schimmel P Acta Crystallogr Sect F Struct Biol Cryst Commun [details] 16511203 -
From cyclohydrolase to oxidoreductase: discovery of nitrile reductase activity in a common fold. Van Lanen SG, Reader JS, Swairjo MA, de Crecy-Lagard V, Lee B, Iwata-Reuyl D Proc Natl Acad Sci U S A [details] 15767583 -
Identification of four genes necessary for biosynthesis of the modified nucleoside queuosine. Reader JS, Metzgar D, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 14660578 -
Mechanistic studies of Bacillus subtilis QueF, the nitrile oxidoreductase involved in queuosine biosynthesis. Lee BW, Van Lanen SG, Iwata-Reuyl D Biochemistry [details] 17929836 -
Structural Basis of Biological Nitrile Reduction. Chikwana VM, Stec B, Lee BW, de Crecy-Lagard V, Iwata-Reuyl D, Swairjo MA J Biol Chem [details] 22787148 -

Last modification of this entry: 2014-05-15 13:04:09.526532
Edited by a user: magda
Edited content: Changed position.