Protein Summary

TsaD from Escherichia coli

Full name: tRNA N6-threonylcarbamoyladenosine(37) synthesis protein
Synonym: YgjD
GI: 16130960
Orf:
COG: COG0533
UniProt: P05852
Structures: | |
Complex: TsaBDE
Enzyme type: threonylcarbamoyltransferase
Position of modification - modification: t:37 - t6A

Comments:

TsaD, the ortholog of eukaryal/archaeal Kae1, is a weak ATPase (produces ADP) and binds A37-containing tRNA. TsaD forms an essential interaction network with TsaB (YeaZ, a paralog of TsaD) and TsaE (YjeE) proteins. Together with TsaC (multiprotein complex), ATP, threonine and bicarbonate as cofactors, they catalyze the in vitro formation of t6A (threonyl-carbamoylation) at position 37 of bacterial tRNA decoding ANN codons (ile, Met, Thr, Lys, Asn, Ser and Arg).

Protein sequence:

MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRD
HVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAF
AWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQ
YELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRP
MTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIK
CKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTD
NGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAA

Enzymatic activities

Reaction Substrate Type Position
A:t6A tRNA (t) 37

Publications

Title Authors Journal Details PubMed Id DOI
Biosynthesis of threonylcarbamoyl adenosine (t6A), a universal tRNA nucleoside. Deutsch C, El Yacoubi B, de Crecy-Lagard V, Iwata-Reuyl D J Biol Chem [details] 22378793 -
A role for the universal Kae1/Qri7/YgjD (COG0533) family in tRNA modification. El Yacoubi B, Hatin I, Deutsch C, Kahveci T, Rousset JP, Iwata-Reuyl D, Murzin AG, de Crecy-Lagard V EMBO J [details] 21285948 -
Effects on transcription of mutations in ygjD, yeaZ, and yjeE genes, which are involved in a universal tRNA modification in Escherichia coli. Hashimoto C, Sakaguchi K, Taniguchi Y, Honda H, Oshima T, Ogasawara N, Kato J J Bacteriol [details] 21873492 -
Mechanism of N6-threonylcarbamoyladenonsine (t(6)A) biosynthesis: isolation and characterization of the intermediate threonylcarbamoyl-AMP. Lauhon CT... Biochemistry [details] 23072323 -

Last modification of this entry: 2014-06-04 20:55:03.490072
Edited by a user: magda
Edited content: Changed complex.