Protein Summary

TrmL from Escherichia coli

Full name: tRNA (cytidine(34)-2′-O)-methyltransferase
Synonym: YibK
GI: 16131477
Orf: b3606, JW3581
COG: COG0219
UniProt: P0AGJ7
Structures: | 4JAK | 4JAL |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:34 - Cm
t:34 - cmnm5Um

Comments:

This small SAM-dependent methyltransferase (157 amino acids) exists as an homodimer. It acts on the ribose of the wobble U or C34 of E. coli tRNALeu harboring an i6A37 modification in the anticodon loop. It allows increasing the performance of the tRNA reading the corresponding complementary codons. The enzyme is not essential for cell viability. Belongs to the SPOUT-type TrmH/TrmL subfamily.

Protein sequence:

MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLD
YHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFG
PETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGY
PGAVLRD

Enzymatic activities

Reaction Substrate Type Position
U:Um tRNA (t) Leu/)AA/prokaryotic cytosol 34
C:Cm tRNA (t) Leu/BAA/prokaryotic cytosol 34
cmnm5U:cmnm5Um tRNA (t) Leu/)AA/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -
YibK is the 2'-O-methyltransferase TrmL that modifies the wobble nucleotide in Escherichia coli tRNA(Leu) isoacceptors. Benitez-Paez A, Villarroya M, Douthwaite S, Gabaldon T, Armengod ME RNA [details] 20855540 -
The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL. Liu RJ, Zhou M, Fang ZP, Wang M, Zhou XL, Wang ED... Nucleic Acids Res [details] 23804755 -
Identification of determinants for tRNA substrate recognition by Escherichia coli C/U34 2'-O-methyltransferase. Zhou M, Long T, Fang ZP, Zhou XL, Liu RJ, Wang ED RNA Biol. [details] 26106808 10.1080/15476286.2015.1050576

Links

_MetaCyc_

Last modification of this entry: 2017-09-14 17:21:23.682625
Edited by a user: elapurta
Edited content: Changed papers.