Protein Summary

TilS from Geobacillus kaustophilus

Full name: tRNA(Ile)2-lysidine synthase
Synonym: GK0060
GI: 56418595
Orf:
COG: COG0037
UniProt: Q5L3T3
Structures: | 3A2K | 3HJ7 |
Complex:
Enzyme type: lysidine synthase
Position of modification - modification: t:34 - k2C

Comments:

The activity was tested only in vitro

Protein sequence:

MIDKVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEWKLQVI
AAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRSAGLGAQ
EAARICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYA
GIPVKRPFHGGYLIRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYTRN
RFRHHIVPLLRQENPRLHERFQQYSEMMAEDEQFLEELAADALNKVMEKQ
HRDAALSIGPFLELPRPLQRRVLQLLLLRLYGGVPPTLTSVHIGHILMLC
ERGRPSGMIDLPKGLKVIRSYDRCLFTFDAESGEKGYWFELPVPALLPLP
NGYAIISEFGEHYPRKQAGNDWFVVDPASVSLPLRVRTRRRGDRMVLKGT
GGTKKLKEIFIEAKIPRMERDRWPIVEDADGRILWVPGLKKSAFEAQNRG
QARYILLQYQAMNS

Enzymatic activities

Reaction Substrate Type Position
C:k2C tRNA (t) Ile/}AU/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
Structural basis for translational fidelity ensured by transfer RNA lysidine synthetase. Nakanishi K, Bonnefond L, Kimura S, Suzuki T, Ishitani R, Nureki O Nature [details] 19847269 -

Last modification of this entry: 2012-10-08 09:55:57.380676
Edited by a user: magda
Edited content: Changed full_name.