Protein Summary

RsmA from Thermus thermophilus

Full name: Ribosomal RNA small subunit methyltransferase A
Synonym: KsgA, TTHA0083
GI: 55980052
Orf:
COG: COG0030
UniProt: Q5SM60
Structures: | 3FUT | 3FUU | 3FUW | 3FUV | 3FUX |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1491(1518) - m6,6A
s:1492(1519) - m6,6A

Comments:

Thermophilic RsmA belongs to the bacterial KsgA/eukaryal-archaeal Dim1 super family of methyltransferases. It dimethylates two very conserved adjacent adenosines (positions 1518 and 1519 in E.coli numbering) in the loop of a conserved hairpin near the 3'-end of small subunit rRNA. AdoMet is the methyl group donor.

Protein sequence:

MSKLASPQSVRALLERHGLFADKRFGQNFLVSEAHLRRIVEAARPFTGPV
FEVGPGLGALTRALLEAGAEVTAIEKDLRLRPVLEETLSGLPVRLVFQDA
LLYPWEEVPQGSLLVANLPYHIATPLVTRLLKTGRFARLVFLVQKEVAER
MTARPKTPAYGVLTLRVAHHAVAERLFDLPPGAFFPPPKVWSSLVRLTPT
GALDDPGLFRLVEAAFGKRRKTLLNALAAAGYPKARVEEALRALGLPPRV
RAEELDLEAFRRLREGLEGAV

Enzymatic activities

Reaction Substrate Type Position
A:m6A rRNA (r) SSU/16S/prokaryotic cytosol 1492
m6A:m6,6A rRNA (r) SSU/16S/prokaryotic cytosol 1492
A:m6A rRNA (r) SSU/16S/prokaryotic cytosol 1493
m6A:m6,6A rRNA (r) SSU/16S/prokaryotic cytosol 1493

Publications

Title Authors Journal Details PubMed Id DOI
Structural rearrangements in the active site of the Thermus thermophilus 16S rRNA methyltransferase KsgA in a binary complex with 5'-methylthioadenosine. Demirci H, Belardinelli R, Seri E, Gregory ST, Gualerzi C, Dahlberg AE, Jogl G J Mol Biol [details] 19285505 -

Links

_PubMed_

Last modification of this entry: 2013-08-05 12:17:54.238181
Edited by a user: magda
Edited content: Changed position.