Protein Summary

Nep1 from Methanocaldococcus jannaschii

Full name: Ribosomal RNA small subunit methyltransferase Nep1
Synonym: MJ0557
GI: 20532166
Orf:
COG: COG1756
UniProt: Q57977
Structures: | 3BBE | 3BBD | 3BBH |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:914(966) - m1Y

Comments:



Protein sequence:

MTYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKE
MRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNY
FRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHP
KLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIIC
YSLSF

Enzymatic activities

Reaction Substrate Type Position
Y:m1Y rRNA (r) SSU/16S/prokaryotic cytosol 914

Publications

Title Authors Journal Details PubMed Id DOI
The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site. Taylor AB, Meyer B, Leal BZ, Kotter P, Schirf V, Demeler B, Hart PJ, Entian KD, Wohnert J Nucleic Acids Res [details] 18208838 -
Backbone resonance assignments of the 48 kDa dimeric putative 18S rRNA-methyltransferase Nep1 from Methanocaldococcus jannaschii. Wurm JP, Duchardt E, Meyer B, Leal BZ, Kotter P, Entian KD, Wohnert J Biomol NMR Assign [details] 19779849 -
The ribosome assembly factor Nep1 responsible for Bowen-Conradi syndrome is a pseudouridine-N1-specific methyltransferase. Wurm JP, Meyer B, Bahr U, Held M, Frolow O, Kotter P, Engels JW, Heckel A, Karas M, Entian KD, Wohnert J Nucleic Acids Res [details] 20047967 -

Links

_PubMed_

Last modification of this entry: Feb. 4, 2014