Protein Summary

Cgi121 from Saccharomyces cerevisiae

Full name:
Synonym: YML036w
GI: 154199620
Orf:
COG: COG1617
UniProt: Q03705
Structures: | |
Complex: EKC/KEOPS
Enzyme type: pseudouridine synthase
Position of modification - modification: t:37 - t6A

Comments:

Absent in bacteria, present only in eykaryota and archaea. Works with other proteins of the KEC/KEOPS complex Bud32, Pcc1 and possibly Gon7.

Protein sequence:

MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSG
EQMYSAIYKTLIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDD
SSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALI
RKIYKLSDDFKPQDVNGLSRALVDAIQLRGV

Publications

Title Authors Journal Details PubMed Id DOI
A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator. Downey M, Houlsworth R, Maringele L, Rollie A, Brehme M, Galicia S, Guillard S, Partington M, Zubko MK, Krogan NJ, Emili A, Greenblatt JF, Harrington L, Lydall D, Durocher D Cell [details] 16564010 -

Links

_PubMed_

Last modification of this entry: Feb. 4, 2014