Protein Summary

TadA from Escherichia coli

Full name: tRNA-specific adenosine deaminase
Synonym: YfhC
GI: 90108581
Orf: yfhC, b2559
COG: COG0590
UniProt: P68398
Structures: | 1Z3A |
Complex:
Enzyme type: deaminase
Position of modification - modification: t:34 - I

Comments:

Homodimeric enzymecontaining zinc. Catalyzes A:I editing in tRNAArg in position 34. The modification is essential for proper decoding. Structure in complex with RNA was solved for Staphylococcus aureus (2B3J).

Protein sequence:

MRRAFITGVFFLSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNR
VIGEGWNRPIGRHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVM
CAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILAD
ECAALLSDFFRMRRQEIKAQKKAQSSTD

Enzymatic activities

Reaction Substrate Type Position
A:I tRNA (t) Arg/ICG/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli. Wolf J, Gerber AP, Keller W EMBO J [details] 12110595 -
Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase. Kim J, Malashkevich V, Roday S, Lisbin M, Schramm VL, Almo SC Biochemistry [details] 16700551 -
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -

Links

_EcoCyc_
_Wikipedia_-_Deamination_
_Wikipedia_-_RNA_editing_

Last modification of this entry: 2012-07-04 13:11:55.568057
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.