Protein Summary

Cgi121 from Methanocaldococcus jannaschii

Full name:
Synonym: MJ0187
GI: 15668359
Orf:
COG: COG1617
UniProt: Q57646
Structures: | 2K8Y | 3ENH |
Complex: EKC/KEOPS
Enzyme type: pseudouridine synthase
Position of modification - modification: t:37 - t6A

Comments:

Absent in bacteria, present only in eykaryota and archaea. Works with other proteins of the KEC/KEOPS complex Bud32, Pcc1 and possibly Gon7.

Protein sequence:

MIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIA
KSFWMEILVRASGQRQIHEAIKIIGAKDGNVCLICEDEETFRKIYELIGG
EIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE

Publications

Title Authors Journal Details PubMed Id DOI
Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine. Mao DY, Neculai D, Downey M, Orlicky S, Haffani YZ, Ceccarelli DF, Ho JS, Szilard RK, Zhang W, Ho CS, Wan L, Fares C, Rumpel S, Kurinov I, Arrowsmith CH, Durocher D, Sicheri F Mol Cell [details] 18951093 -

Links

_PubMed_

Last modification of this entry: Feb. 4, 2014