Protein Summary

Cbf5 from Pyrococcus furiosus

Full name:
Synonym: PF1785
GI: 18978157
Orf:
COG: COG0130
UniProt: Q7LWY0
Structures: | 3HJW | 3HJY |
Complex: H/ACA RNP
Enzyme type: pseudouridine synthase
Position of modification - modification: l:many - Y
n:many - Y
t:many - Y
s:many - Y

Comments:

Archaeal Cbf5 is the catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA box snoRNP) complex. It catalyzes the pseudouridylation of rRNA, snRNA and also intron-containing pre-tRNA. It works with 3 other subunits, Gar1, Nop10 (two homologs of eukaryotic Gar1p/Nop10p), and ribosomal protein L7Ae that is unique to Archaea. However, only Nop10 seems important for tRNA modification. Archaeal L7Ae is the only core protein that is also shared by the C/D box snoRNP. Comparison of archaeal Cbf5 with bacterial tRNA Psi55 synthase (TruB) reveals structural conservation and provides insight into the guide-independent activity of archaeal Cbf5.

Protein sequence:

MARDEVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVIN
LDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVV
QALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRL
RTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSEL
RRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHL
PKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALG
KAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWEKRDRS

Publications

Title Authors Journal Details PubMed Id DOI
Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA. Liang B, Zhou J, Kahen E, Terns RM, Terns MP, Li H Nat Struct Mol Biol [details] 19478803 -
Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase. Duan J, Li L, Lu J, Wang W, Ye K Mol Cell [details] 19481523 -
Identification of determinants in the protein partners aCBF5 and aNOP10 necessary for the tRNA:Psi55-synthase and RNA-guided RNA:Psi-synthase activities. Muller S, Fourmann JB, Loegler C, Charpentier B, Branlant C Nucleic Acids Res [details] 17704128 -
Differential roles of archaeal box H/ACA proteins in guide RNA-dependent and independent pseudouridine formation. Gurha P, Joardar A, Chaurasia P, Gupta R RNA Biol [details] 17993784 -
Pseudouridine formation in archaeal RNAs: The case of Haloferax volcanii. Blaby IK, Majumder M, Chatterjee K, Jana S, Grosjean H, de Crecy-Lagard V, Gupta R RNA [details] 21628430 -

Links

_PubMed_
_Wikipedia - snoRNA_
_Wikipedia - pseudouridylate_synthase_

Last modification of this entry: 2012-08-20 13:17:28.127834
Edited by a user: magda
Edited content: Changed additional_information.