Protein Summary

Bud32 from Saccharomyces cerevisiae

Full name: Serine/threonine-protein kinase BUD32
Synonym: PRPK, LDB14, YGR262c
GI: 6321701
Orf:
COG: COG3642
UniProt: P53323
Structures: | |
Complex: EKC/KEOPS
Enzyme type: kinase
Position of modification - modification: t:37 - t6A

Comments:

This protein is present only in Eukaryota and Archaea, it is absent in Bacteria. It is a RIO-type kinase (PRPK), a p53-related protein kinase in human. At variance with most archaeal Bud32, the S. cerevisiae Bud32 is not fused to SceKae1

Protein sequence:

MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYI
IKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPY
NGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIG
LLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLY
VLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEV
RLRGRKRSMLG

Publications

Title Authors Journal Details PubMed Id DOI
The universal Kae1 protein and the associated Bud32 kinase (PRPK), a mysterious protein couple probably essential for genome maintenance in Archaea and Eukarya. Hecker A, Graille M, Madec E, Gadelle D, Le Cam E, van Tilbergh H, Forterre P Biochem Soc Trans [details] 19143597 -

Links

_PubMed_

Last modification of this entry: 2012-08-31 12:41:44.257205
Edited by a user: magda
Edited content: Changed protein_sequence and additional_information.