Protein Summary

aTrm56 from Pyrococcus horikoshii

Full name: tRNA (cytidine(56)-2'-O)-methyltransferase
Synonym: PH0461
GI: 14590372
Orf:
COG: COG1303
UniProt: O58214
Structures: | 2YY8 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:56 - Um

Comments:

The activity was tested in vitro on tRNAVal transcript.

Protein sequence:

MIKMIVVLRLGHRPERDKRVTTHVALTARAFGADGIIIASEEDEKVKESV
EDVVKRWGGPFFIEFNRNWRKVMKEFTGVKVHLTMYGLHVDDVIEELKEK
LKKGEDFMIIVGAEKVPREVYELADYNVAIGNQPHSEVAALAVLLDRLLE
GKGLKKEFKGAKIKIVPQARGKKVVEVQGYAEQDKAEGKATPGKNWENSG
FTGDNP

Enzymatic activities

Reaction Substrate Type Position
U:Um tRNA (t) Val/unknown/prokaryotic cytosol 56

Publications

Title Authors Journal Details PubMed Id DOI
Crystal structure and mutational study of a unique SpoU family archaeal methylase that forms 2'-O-methylcytidine at position 56 of tRNA. Kuratani M, Bessho Y, Nishimoto M, Grosjean H, Yokoyama S J Mol Biol [details] 18068186 -
The Cm56 tRNA modification in archaea is catalyzed either by a specific 2'-O-methylase, or a C/D sRNP. Renalier MH, Joseph N, Gaspin C, Thebault P, Mougin A RNA [details] 15987815 -

Links

_PubMed_

Last modification of this entry: 2012-06-23 14:07:02.717516
Edited by a user: magda
Edited content: