Protein Summary

Bud23 from Saccharomyces cerevisiae

Full name: Bud23
Synonym:
GI: 140499
Orf: YCR47C
COG: COG2230
UniProt: P25627
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1575(1338) - m7G

Comments:

Bud23 methylates N7 atom of the highly conserved G1575 (m7G) located in a single stranded region between stem 29 and hairpin 42 of domain III in 18S rRNA (in E. coli it is the G1338, not methylated). Bud23 has a dual function, it is involved in both the processes of rRNA modification and nuclear export of small subunit pre-particles. Synthetic lethality was demonstrated with Rps15p, an essential ribosomal protein involved in nuclear export of small subunits pre-particles. Interaction with Trm112 is required for Bud23 activity.

Protein sequence:

MSRPEELAPPEIFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSF
ILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDM
GTGIPFRAGSFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLYAALKK
GGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLS
SGAPPQGEEQVNLDGVTMDEENVNLKKQLRQRLKGGKDKESAKSFILRKK
ELMKRRGRKVAKDSKFTGRKRRHRF

Enzymatic activities

Reaction Substrate Type Position
G:m7G rRNA (r) SSU/18S/cytosolic 1575

Publications

Title Authors Journal Details PubMed Id DOI
Bud23 methylates G1575 of 18S rRNA and is required for efficient nuclear export of pre-40S subunits. White J, Li Z, Sardana R, Bujnicki JM, Marcotte EM, Johnson AW Mol Cell Biol [details] 18332120 -
Genetic interactions show the importance of rRNA modification machinery for the role of Rps15p during ribosome biogenesis in S. cerevisiae. Bellemer C, Chabosseau P, Gallardo F, Gleizes PE, Stahl G PLoS One [details] 20454621 -
Trm112 Is Required for Bud23-Mediated Methylation of the 18S rRNA at Position G1575. Figaro S, Wacheul L, Schillewaert S, Graille M, Huvelle E, Mongeard R, Zorbas C, Lafontaine DL, Heurgue-Hamard V Mol Cell Biol [details] 22493060 -
Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes. Letoquart J, Huvelle E, Wacheul L, Bourgeois G, Zorbas C, Graille M, Heurgue-Hamard V, Lafontaine DL... Proc Natl Acad Sci U S A [details] 25489090 -

Links

_PubMed_
_SGD_

Last modification of this entry: 2014-12-15 10:43:48.841794
Edited by a user: magda
Edited content: Changed papers.