Protein Summary

TiaS from Archaeoglobus fulgidus

Full name: tRNA(Ile2) 2-agmatinylcytidine synthase TiaS
Synonym: AF_2259
GI: 74511356
Orf:
COG: COG1571
UniProt: O28025
Structures: | 3AMU | 3AU7 | 3AMT |
Complex:
Enzyme type: agmatidine synthase
Position of modification - modification:

Comments:

Archaeal TiaS catalyzing formation of agmatidine plays the same decoding role as bacterial TilS catalyzing the formation of lysidine (k2C) in the wobble position of tRNAIle(CAU). Moreover in comparison to bacterial TilS, TiaS has an additional function (phosphorylation of C2 atom of the wobble cytidine-34 as well as autophosphorylation of Thr18 of TiaS).

Protein sequence:

MRVWVGIDDTDSSRGMCTTYLAVLAMERVERELGKVIGFPRLIRLNPTIP
YKTRGNGAVSFLVEVDDVGELVDVVNEVIIEHAMLDDEKTNPGAVFVDEE
LAVKLKPFADKAIKDVLQIDEALFVIGKYFIPHLRHKKGRGLIGALAAVG
AELEDFTLELIAYRYPERFGTEREYDEESFFDMDYELYPQTFDNVDWCND
VVVCIPNTPCPVLYGIRGESVEALYKAMESVKTEPVDRRMIFVTNHATDM
HLIGEEEVHRLENYRSYRLRGRVTLEPYDIEGGHVFFEIDTKFGSVKCAA
FEPTKQFRNVIRLLRKGDVVEVYGSMKKDTINLEKIQIVELAEIWVEKNP
ICPSCGRRMESAGRGQGFRCKKCRTKADEKLREKVERELQPGFYEVPPSA
RRHLSKPLIRMNVEGRHIFR

Enzymatic activities

Reaction Substrate Type Position
C:C+ tRNA (t) Ile/CAU/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
Agmatine-conjugated cytidine in a tRNA anticodon is essential for AUA decoding in archaea. Ikeuchi Y, Kimura S, Numata T, Nakamura D, Yokogawa T, Ogata T, Wada T, Suzuki T, Suzuki T Nat Chem Biol [details] 20139989 -
Structural basis of tRNA agmatinylation essential for AUA codon decoding. Osawa T, Kimura S, Terasaka N, Inanaga H, Suzuki T, Numata T Nat Struct Mol Biol [details] 22002223 -
Biogenesis of 2-agmatinylcytidine catalyzed by the dual protein and RNA kinase TiaS. Terasaka N, Kimura S, Osawa T, Numata T, Suzuki T Nat Struct Mol Biol [details] 22002222 -

Last modification of this entry: 2012-10-08 09:57:44.754913
Edited by a user: magda
Edited content: Changed full_name.