Protein Summary

TrmY from Methanocaldococcus jannaschii

Full name: tRNA(pseudouridine54-N1)-methyltransferase
Synonym: MJ1640
GI: 15669836
Orf:
COG: COG1901
UniProt: Q59034
Structures: | 3AI9 | 3AIA |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m1Y

Comments:

AdoMet dependent methyltransferase. It was shown to catalyze Y:m1Y reaction in vitro in position 54 of a synthetic substrate resembling tRNATrp. Requires pseudouridine (or possibly uridine) in position 55 for efficient conversion of Y54 to m1Y54. This modification is located in the T-loop and is important for the tertiary structure of the tRNA molecule.

Protein sequence:

MREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDV
VFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEE
QRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIEN
PVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKK
RICEI

Enzymatic activities

Reaction Substrate Type Position
Y:m1Y tRNA (t)   54

Publications

Title Authors Journal Details PubMed Id DOI
The archaeal COG1901/DUF358 SPOUT-methyltransferase members, together with pseudouridine synthase Pus10, catalyze the formation of 1-methylpseudouridine at position 54 of tRNA. Chatterjee K, Blaby IK, Thiaville PC, Majumder M, Grosjean H, Yuan YA, Gupta R, de Crécy-Lagard V RNA [details] 22274953 -
Identification of the enzyme responsible for N1-methylation of pseudouridine 54 in archaeal tRNAs. Wurm JP, Griese M, Bahr U, Held M, Heckel A, Karas M, Soppa J, Wöhnert J RNA [details] 22274954 -
Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase. Chen HY, Yuan YA J Mol Cell Biol [details] 21098051 -

Last modification of this entry: 2012-08-28 18:09:40.521506
Edited by a user: magda
Edited content: Changed comments.