Protein Summary

TadA from Arabidopsis thaliana

Full name: tRNA-specific adenosine deaminase, chloroplastic
Synonym: AtTadA
GI: 15221490
Orf: F14K14.18, F24J5.5
COG: COG0590
UniProt: Q9S7I0
Structures: | |
Complex:
Enzyme type: deaminase
Position of modification - modification: t:34 - I

Comments:

A-to-I tRNA editing enzyme from chloroplasts. This enzyme has an unusual structure in that it harbors a large N-terminal domain of more than 1000 amino acids long which is not required for catalytic activity. Only the C-terminal region displays sequence similarity to the tRNA adenosine deaminase TadA from Escherichia coli. Moreover, AtTadA is imported into the chloroplast in vivo.

Protein sequence:

MFNTYTNSLQWPIRSRNQQDYCSLLPERSESYKLSKAYTSSRCYCVSSRS
SCCCCCSTPSSSSFVKPKVLINPGFVLYGVRQSTLIQWPSFQRRLLVGGG
RLMGCEVYSSCDGIRRKNRSFKLRCLEESDECCGGRSCSDDVEAMISFLS
EELIDEERKWNLVSRVKEKKKVGNVRKVSVEGSNSYGNGRVSQRVKKPEG
FGRRKEIKEDVKLNERYDCEHCGRRKKSSELESESRRGSKLVTGEYIGKS
YRGDEEREVRPRRRKSSSCSSYYSLASSGEFESDTEDQEEDVEIYRENVR
SSEKKVVDQSAKRLKSRKEASQMHSRKKRDESSTGVDSRYQKQIFEEGEN
SNQAVTLNQRRRKKFSQTENRVSESTGNYEEDMEIHEVHVNDAETSSQNQ
KLFNEREDYRVHSIRNDSGNENIESSQHQLKERLETRYSSEDRVSEMRRR
TKYSSSQEEGINVLQNFPEVTNNQQPLVEERISKQAGTRRTTEHISESSE
IHDIDIRNTYVSQREDQIRNQEVHAGLVSGLQSERKQQDYHIEHNPLQTT
QSDRTSVSVSHTSDAVRYTEIQRKSEKRLIGQGSTTAVQSDSKVEKNGAQ
KEDSRLDHANSKKDGQTTLGLQSYQSKLSEEASSSQSSLMASRTKLQLVD
LVSEEMQGSETTLIPPSSQLVSRRSGQSYRTGGVSIQEISHGTSESGYTT
AFEHPRAGASVNSQSAGELMGFTSHEDAMGSAHRLEQASEKYVGEFVKKA
KHGVINPETEEQRAESNQLKRRDSRRSSGGSGAKGPSDEMWVTDSAQGTP
HPGATEGNAAVGNAIFKRNGRSLWNVIADIARLRWGSRAGSPDSSAKPAG
RSSPNESVSSATWFSGREHDGSSDDNTKGDKVLPQEAPSLHQVEVGQTSP
RSQSEYPGTTKLKQRSERHEGVVSSPSSTILEGGSVSNRMSSTSGNQIVG
VDEEEGGNFEFRLPETALTEVPMKLPSRNLIRSPPIKESSESSLTEASSD
QNFTVGEGRRYPRMDAGQNPLLFPGRNLRSPAVMEPPVPRPRMVSGSSSL
REQVEQQQPLSAKSQEETGSVSADSALIQRKLQRNKQVVRDSFEEWEEAY
KVEAERRTVDEIFMREALVEAKKAADTWEVPVGAVLVHDGKIIARGYNLV
EELRDSTAHAEMICIREGSKALRSWRLADTTLYVTLEPCPMCAGAILQAR
VNTLVWGAPNKLLGADGSWIRLFPGGEGNGSEASEKPPPPVHPFHPKMTI
RRGVLESECAQTMQQFFQLRRKKKDKNSDPPTPTDHHHHHLPKLLNKMHQ
VLPFFCL

Enzymatic activities

Reaction Substrate Type Position
A:I tRNA (t) Arg/ICG/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
Identification of the chloroplast adenosine-to-inosine tRNA editing enzyme. Karcher D, Bock R RNA [details] 19460869 -
Arabidopsis tRNA adenosine deaminase arginine edits the wobble nucleotide of chloroplast tRNAArg(ACG) and is essential for efficient chloroplast translation. Delannoy E, Le Ret M, Faivre-Nitschke E, Estavillo GM, Bergdoll M, Taylor NL, Pogson BJ, Small I, Imbault P, Gualberto JM Plant Cell [details] 19602623 -
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -

Links

_TAIR_
_Wikipedia - Deamination_
_Wikipedia - RNA editing_

Last modification of this entry: 2012-07-04 13:12:06.083863
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.