Protein Summary

TusE from Escherichia coli

Full name: tRNA 2-thiouridine synthesizing protein E
Synonym: yccK
GI: 90111197
Orf:
COG: COG2920
UniProt: P0AB18
Structures: | |
Complex:
Enzyme type: sulfurtransferase
Position of modification - modification:

Comments:

TusE binds TusBCD complex and stimulates sulfur transfer from TusA to TusD. TusE also interacts with a MnmA-tRNA complex. It is necessary for sulfur transfer from IscS cysteine desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions.

Protein sequence:

MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFV
RDFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIA
GLPKPVKCI

Publications

Title Authors Journal Details PubMed Id DOI
Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T Mol Cell [details] 16387657 -

Links

_EcoCyc_
_PubMed_

Last modification of this entry: 2012-07-04 13:42:02.303234
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme and comments.