Protein Summary

TusD from Escherichia coli

Full name: tRNA 2-thiouridine(34) synthase
Synonym: yheN
GI: 16131224
Orf:
COG: COG1553
UniProt: P45532
Structures: | 2D1P |
Complex: TusBCD
Enzyme type: sulfurtransferase
Position of modification - modification:

Comments:

Part of a TusBCD complex which functions as a heterohexamer (a dimer of the heterotrimer). TusBCD complex participates in sulfur transfer from IscS cystein desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions. It mediates sulfur relay via a putative persulfide state of the TusD subunit. It transfers sulfur from TusA to TusE.

Protein sequence:

MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELSSVFFYREGVYNANQL
TSPASDEFDLVRAWQQLNAQHGVALNICVAAALRRGVVDETEAGRLGLAS
SNLQQGFTLSGLGALAEASLTCDRVVQF

Publications

Title Authors Journal Details PubMed Id DOI
Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T Mol Cell [details] 16387657 -
Structural basis for sulfur relay to RNA mediated by heterohexameric TusBCD complex. Numata T, Fukai S, Ikeuchi Y, Suzuki T, Nureki O Structure [details] 16472754 -

Links

_EcoCyc_
_PubMed_

Last modification of this entry: 2013-02-19 12:22:32.434014
Edited by a user: magda
Edited content: Changed enzyme_type.