Protein Summary

TusB from Escherichia coli

Full name: tRNA 2-thiouridine(34) synthase
Synonym: yheL
GI: 16131222
Orf:
COG: COG2168
UniProt: P45530
Structures: | 2D1P |
Complex: TusBCD

Comments:

Part of a TusBCD complex which functions as a heterohexamer (a dimer of the heterotrimer). TusBCD complex participates in sulfur transfer from IscS cystein desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions. It mediates sulfur relay via a putative persulfide state of the TusD subunit. It transfers sulfur from TusA to TusE.

Protein sequence:

MLHTLHRSPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNA
PIKVYALNEDLIARGLTGQISNDIILIDYTDFVRLTVKHPSQMAW

Publications

Title Authors Journal Details PubMed Id DOI
Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T Mol Cell [details] 16387657 -
Structural basis for sulfur relay to RNA mediated by heterohexameric TusBCD complex. Numata T, Fukai S, Ikeuchi Y, Suzuki T, Nureki O Structure [details] 16472754 -

Links

_EcoCyc_
_PubMed_

Last modification of this entry: 2012-01-12 10:05:35.539676
Edited by a user: magda
Edited content: Changed additional_information.