Protein Summary

TusA from Escherichia coli

Full name: tRNA 2-thiouridine(34) synthase
Synonym: sirA, yhhP
GI: 16131342
Orf:
COG: COG0425
UniProt: P0A890
Structures: | 3LVK | 3LVJ | 1DCJ |
Complex:
Enzyme type: sulfurtransferase
Position of modification - modification:

Comments:

TusA is a part of sulfur-relay system required for sulfur transfer from IscS cysteine desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions. TusA accepts a sulfur from IscS and transfers it to TusD.

Protein sequence:

MTDLFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTR
DIPGFCTFMEHELVAKETDGLPYRYLIRKGG

Publications

Title Authors Journal Details PubMed Id DOI
Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions. Shi R, Proteau A, Villarroya M, Moukadiri I, Zhang L, Trempe JF, Matte A, Armengod ME, Cygler M PLoS Biol [details] 20404999 -
Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T Mol Cell [details] 16387657 -
High precision NMR structure of YhhP, a novel Escherichia coli protein implicated in cell division. Katoh E, Hatta T, Shindo H, Ishii Y, Yamada H, Mizuno T, Yamazaki T J Mol Biol [details] 11080457 -

Links

_EcoCyc_
_PubMed_

Last modification of this entry: 2012-07-04 13:40:42.289168
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme and comments.