Protein Summary

MnmE from Chlorobium tepidum

Full name: tRNA modification GTPase MnmE
Synonym: ThdF, TrmE
GI: 21674894
Orf:
COG: COG0486
UniProt: Q8KAS1
Structures: | 3GEE | 3GEI |
Complex: MnmE/MnmG
Enzyme type: GTPase
Position of modification - modification: t:34 - cmnm5s2U
t:34 - cmnm5U

Comments:

Homologue of E. coli MnmE. Hydrolyses GTP (contains a P-loop domain). MnmE works as dimer in complex with MnmG (GidA also as dimer). Catalyzes two independent reactions according to substrate (glycine or ammonium).

Protein sequence:

MSPSDLHLPVPGHPIAAIATPVGVGALAIVRISGAGVLDLADRVFRKVHG
SGKLAEAAGYTAHFGRLYDGEEMVDEVIALVFRAPRSFTAEQMVEFTCHG
GPVVVGRVLRLMLDNGCRLAEPGEFTRRAFLNGRIDLLQAEAIGEMIHAR
TESAYRTAVSQMKGDLSVRLGGLREQLIRSCALIELELDFSEEDVEFQSR
DELTMQIETLRSEVNRLIDSYQHGRIVSEGVSTVIAGKPNAGKSTLLNTL
LGQERAIVSHMPGTTRDYIEECFIHDKTMFRLTDTAGLREAGEEIEHEGI
RRSRMKMAEADLILYLLDLGTERLDDELTEIRELKAAHPAAKFLTVANKL
DRAANADALIRAIADGTGTEVIGISALNGDGIDTLKQHMGDLVKNLDKLH
EASVLVTSLRHYEALRNASDALQNALELIAHESETELIAFELRAALDYVG
QITGKVVNEEVLNTIFDKFCIGK

Enzymatic activities

Reaction Substrate Type Position
Um:cmnm5Um tRNA (t)   34
s2U:nm5s2U tRNA (t)   34
se2U:nm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t)   34
se2U:cmnm5se2U tRNA (t)   34
U:nm5U tRNA (t)   34
U:cmnm5U tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
Kissing G domains of MnmE monitored by X-ray crystallography and pulse electron paramagnetic resonance spectroscopy. Meyer S, Bohme S, Kruger A, Steinhoff HJ, Klare JP, Wittinghofer A PLoS Biol [details] 19806182 -
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -

Links

_PubMed_

Last modification of this entry: 2012-11-30 14:45:03.978814
Edited by a user: magda
Edited content: Changed comments.