Protein Summary

MnmG from Aquifex aeolicus

Full name: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG
Synonym: GidA
GI: 15606146
Orf:
COG: COG0445
UniProt: O66962
Structures: | 2ZXH | 2ZXI |
Complex: MnmG/MnmE
Enzyme type: other
Position of modification - modification: t:34 - cmnm5s2U
t:34 - cmnm5U

Comments:

Homologue of E. coli MnmG. Flavoprotein, using methyl-(or methylen)-tetrahydrofolate as a donor of one carbon. In a complex with GTPase MnmE they catalyze the formation of either cmnm5U or nm5U by reacting either with glycine or with ammonium.

Protein sequence:

MAWVVDEFDVVVIGGGHAGIEAALAAARMGAKTAMFVLNADTIGQMSCNP
AIGGIAKGIVVREIDALGGEMGKAIDQTGIQFKMLNTRKGKAVQSPRAQA
DKKRYREYMKKVCENQENLYIKQEEVVDIIVKNNQVVGVRTNLGVEYKTK
AVVVTTGTFLNGVIYIGDKMIPGGRLGEPRSEGLSDFYRRFDFPLIRFKT
GTPARLDKRTIDFSALEVAPGDDPPPKFSFWTEPVGSYWFPKGKEQVNCW
ITYTTPKTHEIIRKNLHRTALYGGLIKGIGPRYCPSIEDKIVKFPDKERH
QIFLEPEGLDTIEIYPNGLSTSLPEEVQWEMYRSIPGLENVVLIRPAYAI
EYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAAL
RAFGKEPIYLRRDESYIGVMIDDLTTKGVTEPYRLFTSRSEYRLYIRQDN
AILRLAKLGRELGLLSEEQYKLVKELEREIEKWKEFYKSERVSVAVGGDT
RSYSVATLMTMNYTLDDVKEKFGYEVPQHPYVKEEVEIQLKYEPYIERER
KLNEKLKKLEDTKIPPDIDYDKIPGLTKEAREKLKKFKPITVGQASRIDG
ITPAAITALLVYLGKLD

Enzymatic activities

Reaction Substrate Type Position
Um:cmnm5Um tRNA (t)   34
s2U:nm5s2U tRNA (t)   34
se2U:nm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t)   34
se2U:cmnm5se2U tRNA (t)   34
U:nm5U tRNA (t)   34
U:cmnm5U tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
Conserved cysteine residues of GidA are essential for biogenesis of 5-carboxymethylaminomethyluridine at tRNA anticodon. Osawa T, Ito K, Inanaga H, Nureki O, Tomita K, Numata T Structure [details] 19446527 -
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -
SAXS analysis of the tRNA-modifying enzyme complex MnmE/MnmG reveals a novel interaction mode and GTP-induced oligomerization. Fislage M, Brosens E, Deyaert E, Spilotros A, Pardon E, Loris R, Steyaert J, Garcia-Pino A, Versees W... Nucleic Acids Res [details] 24634441 -

Links

_PubMed_

Last modification of this entry: 2014-03-20 11:55:33.212177
Edited by a user: magda
Edited content: Changed papers.