Protein Summary

MnmG from Chlorobium tepidum

Full name: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG
Synonym: GidA
GI: 21675089
Orf:
COG: COG0445
UniProt: Q8KA85
Structures: | 3CP8 |
Complex: MnmG/MnmE
Enzyme type: other
Position of modification - modification: t:34 - cmnm5s2U
t:34 - cmnm5U

Comments:

Homologue of E. coli MnmG. Flavoprotein, using methyl-(or methylen)-tetrahydrofolate as a donor of one carbon. In a complex with GTPase MnmE they catalyze the formation of either cmnm5U or nm5U by reacting either with glycine or with ammonium.

Protein sequence:

MYDVIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVA
KGQITREIDALGGEMGKAIDATGIQFRMLNRSKGPAMHSPRAQADKTQYS
LYMRRIVEHEPNIDLLQDTVIGVSANSGKFSSVTVRSGRAIQAKAAILAC
GTFLNGLIHIGMDHFPGGRSTAEPPVEGLTESLASLGFSFGRLKTGTPPR
IDSRSVDYTIVTEQPGDVDPVPFSFSSTSVANRNLVSCYLTKTTEKTHDI
LRTGFDRSPLFTGKVQGVGPRYCPSIEDKISRFPDKSSHHIFLEPEGTDT
VEMYVNGFSTSLPEDIQIAGLRSIPGLEEAKMIRPGYAIEYDFFHPWQIR
STMETRPVENLFFAGQINGTSGYEEAAAQGLMAGINAVRKILGKELIVLG
RDQAYIGVLIDDLITKETKEPYRMFTSSAEHRLILRHDNADLRLRKIGYD
CNLVSSDDLHRTESIIKRVQHCLEVMKTAKVTPAEINTLLMNKGLQELKT
PARALSLIKRPGISLQDILEHSLSVRSAAEELCNDPRVAEQVQIEIKYEG
YIKREQLVADRIARLDSLHIPDNFNYDSLNSLSSEGREKLLKHRPATIGQ
ASRILGVSPSDVSILMIRLGR

Enzymatic activities

Reaction Substrate Type Position
U:cmnm5U tRNA (t)   34
U:nm5U tRNA (t)   34
s2U:nm5s2U tRNA (t)   34
se2U:nm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t)   34
se2U:cmnm5se2U tRNA (t)   34
Um:cmnm5Um tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
Crystal structures of the conserved tRNA-modifying enzyme GidA: implications for its interaction with MnmE and substrate. Meyer S, Scrima A, Versées W, Wittinghofer A J Mol Biol [details] 18565343 -
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -

Links

_PubMed_

Last modification of this entry: 2012-07-03 17:17:24.678922
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.