Protein Summary

15.5kD from Giardia lamblia

Full name: Ribosomal protein L7Ae
Synonym:
GI: 159111753
Orf: GL50803_11287
COG: COG1358
UniProt: A8BMJ0
Structures: | 3O85 |
Complex: C/D RNP

Comments:

15.5kD protein is a homologue of yeast Snu13 and archaeal L7Ae. Binds to a common kink-turn motif of RNA. Together with Nop56, Nop58 and fibrillarine they make the core of the heteromeric C/D RNP complex. It is also part of the eukaryotic pre-mRNA splicesomal RNP apparatus. The crystal structure of the human homologue has been solved (PDB ID: 1E7K, 2OZB).

Protein sequence:

MQIDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAEL
VIIAADADPIEIVLHLPLACEDKGVPYVFIGSKNALGRACNVSVPTIVAS
IGKHDALGNVVAEIVGKVEALV

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2014-05-27 13:10:00.726463
Edited by a user: magda
Edited content: Changed papers.