Protein Summary

L7Ae from Sulfolobus solfataricus

Full name: 50S ribosomal protein L7Ae
Synonym: rpl7ae, SSO0091
GI: 15897054
Orf: C04_031
COG: COG1358
UniProt: P55858
Structures: | 3ICX | 3ID5 | 3ID6 |
Complex: C/D RNP

Comments:

L7Ae protein, together with fused Nop56/58 (also designated Nop5) and Fibrillarin methyltranferase (FlpA), makes the core of C/D RNP complex in Archaea. It is a homologue of S. cerevisiae Snu13 and mammalian 15.5kD protein. Archaeal L7Ae is also a subunit of H/ACA RNP complex, a subunit of RNase P and one of the ribosomal protein of the 50S subunit. In all cases L7Ae binds to a common kink-turn motif of RNA.

Protein sequence:

MNAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQ
AKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATA
SAAILEPGEAKDLVDEIIKRVNEIKGKTSS

Publications

Title Authors Journal Details PubMed Id DOI
Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K, Jia R, Lin J, Ju M, Peng J, Xu A, Zhang L Proc Natl Acad Sci U S A [details] 19666563 -
Structural basis for site-specific ribose methylation by box C/D RNA protein complexes. Lin J, Lai S, Jia R, Xu A, Zhang L, Lu J, Ye K Nature [details] 21270896 -

Links

_PubMed_

Last modification of this entry: 2012-11-30 12:52:25.221991
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, additional_information and comments.