Protein Summary

Tad1 from Saccharomyces cerevisiae

Full name: tRNA-specific adenosine deaminase 1
Synonym: ADAT1, YGL243W
GI: 1723979
Orf: HRA400
COG: COG0590
UniProt: P53065
Complex:
Enzyme type: deaminase
Position of modification - modification: t:37 - m1I

Comments:

Tad1 (ADAT1) catalyze the A-to-I deamination which is the first step in m1I synthesis in tRNA position 37. Zinc enzyme.

Protein sequence:

MVSCQGTRPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSG
IREWTILAGVAAINRDGGANKIEILSIATGVKALPDSELQRSEGKILHDC
HAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARFNLKENWELAL
YISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNF
NRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFL
KYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDV
PGLMCSVKLFMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQW
ELFKKIRPEYEGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDVK

Enzymatic activities

Reaction Substrate Type Position
A:I tRNA (t) Ala/IGC/prokaryotic cytosol 37

Publications

Title Authors Journal Details PubMed Id DOI
Tad1p, a yeast tRNA-specific adenosine deaminase, is related to the mammalian pre-mRNA editing enzymes ADAR1 and ADAR2. Gerber A, Grosjean H, Melcher T, Keller W EMBO J [details] 9707437 -
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -

Links

_SGD_
_Wikipedia_-_Deamination_
_Wikipedia_-_RNA_editing_

Last modification of this entry: 2012-07-04 13:09:55.111535
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.