Protein Summary

TYW3 from Saccharomyces cerevisiae

Full name: tRNA wybutosine-synthesizing protein 3
Synonym: YGL050W
GI: 1322543
Orf:
COG: COG1590
UniProt: P53177
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - yW

Comments:

TYW3 takes part in wyosine synthesis. It methylates N-4 position of yW-86 in Ado-Met-dependent manner to yield yW-72.

Protein sequence:

MAAQNAFEQKKRAILNEIDSTQPDLSPKGTIDELCLPIIDLINASADMVT
TSSCSGRVSVFLEGTKSYNGEVKIGGKGQGGKWLYVTHDREKVIGWLDEL
KSKSEFSFELSGKEIPTEKVTGSIRYILYKYEPFILHVKCRDFQAASKLY
NTAMSCGFRESGIGSNNLVAIRINIKLDVPLGYLDETSGTLKFFVTPEYV
SVLDSLSLSKFDENTRKMQALYDRIEKELINCAPDVNSKVNITPIETKEE
RRERKKREGMERQRQLKSPQNVL

Enzymatic activities

Reaction Substrate Type Position
yW-86:yW-72 tRNA (t) Phe/#AA/cytosolic 37
yW-86:yW-72 tRNA (t) Phe/#AA/cytosolic 37

Publications

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA. Noma A, Kirino Y, Ikeuchi Y, Suzuki T EMBO J [details] 16642040 -

Links

_PubMed_
_SGD_

Last modification of this entry: 2012-08-21 15:25:16.034813
Edited by a user: magda
Edited content: No fields changed.