Protein Summary

TrmM from Escherichia coli

Full name: tRNA (adenosine(37)-N6)-methyltransferase
Synonym: YfiC, TrmN6
GI: 13638617
Orf:
COG: COG4123
UniProt: P31825
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m6A

Comments:

SAM-dependent tRNA (adenine-N(6)-)-methyltransferase; modifies A37 of tRNA1Val(cmo5UAC).

Protein sequence:

MSQSTSVLRRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPVAGVKRCLD
IGAGSGLLALMLAQRTDDSVMIDAVELESEAAAQAQENINQSPWAERINV
HTADIQQWITQQTVRFDLIISNPPYYQQGVECSTPQREQARYTTTLDHPS
LLTCAAECITEEGFFCVVLPEQIGNGFTELALSMGWHLRLRTDVAENEAR
LPHRVLLAFSPQAGECFSDRLVIRGPDQNYSEAYTALTQAFYLFM

Enzymatic activities

Reaction Substrate Type Position
A:m6A tRNA (t) Val/VAC/prokaryotic cytosol 37

Publications

Title Authors Journal Details PubMed Id DOI
The yfiC gene of E. coli encodes an adenine-N6 methyltransferase that specifically modifies A37 of tRNA1Val(cmo5UAC). Golovina AY, Sergiev PV, Golovin AV, Serebryakova MV, Demina I, Govorun VM, Dontsova OA RNA [details] 19383770 -

Last modification of this entry: 2013-02-12 12:53:35.805243
Edited by a user: magda
Edited content: Changed synonym.