Protein Summary

RlmM from Escherichia coli

Full name: Ribosomal RNA large subunit methyltransferase M
Synonym: YgdE
GI: 83287984
Orf: b1976
COG: COG2933
UniProt: P0ADR6
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2498(2498) - Cm

Comments:

RlmM catalyzes the 2′-O-methylation at nucleotide C2498 in a single stranded part of the peptidyl transferase loop (between hairpins 89 and 90, Domain V) of E. coli 23S rRNA. Methylation occurs in naked 23S rRNA, but not in assembled 50S subunits or ribosomes. RlmM is placed in the cluster of orthologous groups COG2933 together with S-adenosylmethionine-dependent, Rossmann-fold methyltransferases (notably fibrillarin Nop1).

Protein sequence:

MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPD
DGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKG
GELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHV
FFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFI
PADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMD
TGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTV
HVRRIWAAVGGRRDER

Enzymatic activities

Reaction Substrate Type Position
C:Cm rRNA (r) LSU/23S/prokaryotic cytosol 2498

Publications

Title Authors Journal Details PubMed Id DOI
YgdE is the 2'-O-ribose methyltransferase RlmM specific for nucleotide C2498 in bacterial 23S rRNA. Purta E, O'Connor M, Bujnicki JM, Douthwaite S Mol Microbiol [details] 19400805 -
RNA nucleotide methylation. Motorin Y, Helm M. Wiley Interdiscip Rev RNA [details] 21823225 -

Last modification of this entry: 2012-07-03 16:29:15.274571
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, comments and papers.