Protein Summary

Abd1 from Saccharomyces cerevisiae

Full name: RNA cap guanine-N7 methyltransferase
Synonym: MceS
GI: 416567
Orf: YBR1602
COG: COG2226
UniProt: P32783
Complex:
Enzyme type: methyltransferase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

AdoMet is the methyl group donor. Responsible for methylating the 5'cap structure of mRNAs. Nucleotide 0 is a cap. Beside its capping function, Abd1 has also a function in transcription by RNA polymerase II. This transcriptional function is independent of methylase activity. The m7G has a positively charge at neutral pH.

Protein sequence:

MSTKPEKPIWMSQEDYDRQYGSITGDESSTVSKKDSKVTANAPGDGNGSL
PVLQSSSILTSKVSDLPIEAESGFKIQKRRHERYDQEERLRKQRAQKLRE
EQLKRHEIEMTANRSINVDQIVREHYNERTIIANRAKRNLSPIIKLRNFN
NAIKYMLIDKYTKPGDVVLELGCGKGGDLRKYGAAGISQFIGIDISNASI
QEAHKRYRSMRNLDYQVVLITGDCFGESLGVAVEPFPDCRFPCDIVSTQF
CLHYAFETEEKARRALLNVAKSLKIGGHFFGTIPDSEFIRYKLNKFPKEV
EKPSWGNSIYKVTFENNSYQKNDYEFTSPYGQMYTYWLEDAIDNVPEYVV
PFETLRSLADEYGLELVSQMPFNKFFVQEIPKWIERFSPKMREGLQRSDG
RYGVEGDEKEAASYFYTMFAFRKVKQYIEPESVKPN

Enzymatic activities

Reaction Substrate Type Position
G:m7G mRNA (m)   1
Gpp(pN):m7Gpp(pN) mRNA (m) 1

Publications

Title Authors Journal Details PubMed Id DOI
Yeast mRNA cap methyltransferase is a 50-kilodalton protein encoded by an essential gene. Mao X, Schwer B, Shuman S Mol Cell Biol [details] 7623811 -
mRNA:guanine-N7 cap methyltransferases: identification of novel members of the family, evolutionary analysis, homology modeling, and analysis of sequence-structure-function relationships. Bujnicki JM, Feder M, Radlinska M, Rychlewski L BMC Bioinformatics [details] 11472630 -
Mutational analysis of the Saccharomyces cerevisiae ABD1 gene: cap methyltransferase activity is essential for cell growth. Mao X, Schwer B, Shuman S Mol Cell Biol [details] 8552073 -
Structure-function analysis of the mRNA cap methyltransferase of Saccharomyces cerevisiae. Wang SP, Shuman S J Biol Chem [details] 9169431 -
Dynamic association of capping enzymes with transcribing RNA polymerase II. Schroeder SC, Schwer B, Shuman S, Bentley D Genes Dev [details] 11018011 -

Links

_PubMed - Abd1 Saccharomyces cap_
_PubMed - Abd1 gene function_
_Wikipedia_

Last modification of this entry: 2012-08-31 12:38:10.917746
Edited by a user: magda
Edited content: No fields changed.