Protein Summary

TmcA from Escherichia coli

Full name: tRNA cytidine(34) acetyltransferase
Synonym: YpfI, JW2459
GI: 2495648
Orf: b2474
COG: COG1444
UniProt: P76562
Structures: | 2ZPA |
Complex:
Enzyme type: acetyltransferase
Position of modification - modification: t:34 - ac4C

Comments:

tRNAMet cytidine acetyltransferase. The substrate of this reaction is elongator tRNAMet. Apart from acetyltransferase it posses also a helicase domain.

Protein sequence:

MAELTALHTLTAQMKREGIRRLLVLSGEEGWCFEHTLKLRDALPGDWLWI
SPRPDAENHCSPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGS
WLVLLLPVWEEWENQPDADSLRWSDCPDPIATPHFVQHLKRVLTADNEAI
LWRQNQPFSLAHFTPRTDWYPATGAPQPEQQQLLKQLMTMPPGVAAVTAA
RGRGKSALAGQLISRIAGRAIVTAPAKASTDVLAQFAGEKFRFIAPDALL
ASDEQADWLVVDEAAAIPAPLLHQLVSRFPRTLLTTTVQGYEGTGRGFLL
KFCARFPHLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTHTPQGNIV
ISAFEQTLWQSDPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAA
GENEIAGALWLVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLA
ATLRGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGYTGEL
WRFWQRCGFVLVRMGNHREASSGCYTAMALLPMSDAGKQLAEREHYRLRR
DAQALAQWNGETLPVDPLNDAVLSDDDWLELAGFAFAHRPLLTSLGCLLR
LLQTSELALPALRGRLQKNASDAQLCTTLKLSGRKMLLVRQREEAAQALF
ALNDVRTERLRDRITQWQLFH

Enzymatic activities

Reaction Substrate Type Position
C:ac4C tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
The RNA acetyltransferase driven by ATP hydrolysis synthesizes N4-acetylcytidine of tRNA anticodon. Ikeuchi Y, Kitahara K, Suzuki T EMBO J [details] 18668122 -
RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon. Chimnaronk S, Suzuki T, Manita T, Ikeuchi Y, Yao M, Suzuki T, Tanaka I EMBO J [details] 19322199 -

Last modification of this entry: 2012-07-04 13:20:57.145593
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.