Protein Summary

RsmG from Escherichia coli

Full name: Ribosomal RNA small subunit methyltransferase G
Synonym: GidB, JW3718
GI: 62288117
Orf: b3740
COG: COG0357
UniProt: P0A6U5
Structures: | 1XDZ | 1JSX |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:527(527) - m7G

Comments:

RsmG is an AdoMet-dependent methyltransferase responsible for the synthesis of m7G527 in the universally conserved loop of hairpin 18 in domain I of bacterial 16S rRNA. Deletion of rsmG gene conferred high-level resistance to the aminoglycoside antibiotics streptomycin and neomycin in Salmonella.

Protein sequence:

MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEML
VRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGK
RVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSW
CHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLV
VIKANKI

Enzymatic activities

Reaction Substrate Type Position
G:m7G rRNA (r) SSU/16S/prokaryotic cytosol 527

Publications

Title Authors Journal Details PubMed Id DOI
Mutations in rsmG, encoding a 16S rRNA methyltransferase, result in low-level streptomycin resistance and antibiotic overproduction in Streptomyces coelicolor A3(2). Nishimura K, Hosaka T, Tokuyama S, Okamoto S, Ochi K J Bacteriol [details] 17384192 -
Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase. Benitez-Paez A, Villarroya M, Armengod ME RNA [details] 22337945 -
Deletion of gene encoding methyltransferase (gidB) confers high-level antimicrobial resistance in Salmonella. Mikheil DM, Shippy DC, Eakley NM, Okwumabua OE, Fadl AA J Antibiot (Tokyo) [details] 22318332 -

Last modification of this entry: 2012-07-04 13:00:29.025855
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.