Protein Summary

QueG from Escherichia coli

Full name: tRNA epoxyqueuosine(34) reductase
Synonym: YjeS
GI: 16131988
Orf:
COG: COG1600
UniProt: P39288
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:34 - QtRNA

Comments:

Vitamine B12 dependent.

Protein sequence:

MSEPLDLNQLAQKIKQWGLELGFQQVGITDTDLSESEPKLQAWLDKQYHG
EMDWMARHGMLRARPHELLPGTLRVISVRMNYLPANAAFASTLKNPKLGY
VSRYALGRDYHKLLRNRLKKLGEMIQQHCVSLNFRPFVDSAPILERPLAE
KAGLGWTGKHSLILNREAGSFFFLGELLVDIPLPVDQPVEEGCGKCVACM
TICPTGAIVEPYTVDARRCISYLTIELEGAIPEELRPLMGNRIYGCDDCQ
LICPWNRYSQLTTEEDFSPRKPLHAPELIELFAWSEEKFLKVTEGSAIRR
IGHLRWLRNIAVALGNAPWDETILTALESRKGEHPLLDEHIAWAIAQQIE
RRNACIVEVQLPKKQRLVRVIEKGLPRDA

Enzymatic activities

Reaction Substrate Type Position
oQtRNA:QtRNA tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
New function of vitamin B12: cobamide-dependent reduction of epoxyqueuosine to queuosine in tRNAs of Escherichia coli and Salmonella typhimurium. Frey B, McCloskey J, Kersten W, Kersten H J Bacteriol [details] 3129401 -
Structure and organization of Escherichia coli genes involved in biosynthesis of the deazaguanine derivative queuine, a nutrient factor for eukaryotes. Reuter K, Slany R, Ullrich F, Kersten H J Bacteriol [details] 1706703 -
Discovery of epoxyqueuosine (oQ) reductase reveals parallels between halorespiration and tRNA modification. Miles ZD, McCarty RM, Molnar G, Bandarian V Proc Natl Acad Sci U S A [details] 21502530 -

Links

_EcoCyc_

Last modification of this entry: 2014-04-24 12:43:25.393383
Edited by a user: magda
Edited content: Changed position.