Protein Summary

RsmH from Escherichia coli

Full name: Ribosomal RNA small subunit methyltransferase H
Synonym: mraW
GI: 42560200
Orf:
COG: COG0275
UniProt: P60390
Structures: | 3TKA |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1402(1402) - m4Cm

Comments:

RsmH methylates N4 atom of C1402 (m4C) within a heavily hypermodified region of helix 44 in the 3’-terminal region of 16S rRNA. AdoMet is the methyl group donor. This enzyme is conserved in almost all species of bacteria. Together with 2’-O-methyltransferase RsmI, it allows the formation of the final product m4Cm. Phylogenetic profiling (co-occurrence) reavealed probable biochemical links between RsmH and translation factors IF2, RF1 and LepA.

Protein sequence:

MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGR
LLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILL
DLGVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAW
VLKTYGEERFAKRIARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHP
ATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIISFHSLEDRIVK
RFMRENSRGPQVPAGLPMTEEQLKKLGGRQLRALGKLMPGEEEVAENPRA
RSSVLRIAERTNA

Enzymatic activities

Reaction Substrate Type Position
Cm:m4Cm rRNA (r) SSU/16S/prokaryotic cytosol 1402
C:m4C rRNA (r) SSU/16S/prokaryotic cytosol 1402
m4C:m4,4C rRNA (r) SSU/16S/prokaryotic cytosol 1402
m4Cm:m4,4Cm rRNA (r) SSU/16S/prokaryotic cytosol 1402

Publications

Title Authors Journal Details PubMed Id DOI
Fine-tuning of the ribosomal decoding center by conserved methyl-modifications in the Escherichia coli 16S rRNA. Kimura S, Suzuki T Nucleic Acids Res [details] 19965768 -
RNA nucleotide methylation. Motorin Y, Helm M. Wiley Interdiscip Rev RNA [details] 21823225 -
Crystal and solution structures of methyltransferase RsmH provide basis for methylation of C1402 in 16S rRNA. Wei Y, Zhang H, Gao ZQ, Wang WJ, Shtykova EV, Xu JH, Liu QS, Dong YH... J Struct Biol [details] 22561317 -

Last modification of this entry: 2014-12-24 11:23:47.485155
Edited by a user: magda
Edited content: Changed papers.