Protein Summary

QueF from Escherichia coli

Full name: preQ1 synthase
Synonym: YgcD
GI: 2495654
Orf: yqcD, b2794
COG: COG2904
UniProt: Q46920
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:34 - QtRNA

Comments:

Reaction preQ0base:preQ0 does not occur under physiological conditions, because normally all preQ0(b) is converted to preQ1(b) by QueF.

Protein sequence:

MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLP
FHGTDIWTLYELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSF
NQTRFNNWDEVRQTLERDLSTCAQGKISVALYRLDELEGQPIGHFNGTCI
DDQDITIDNYEFTTDYLENATCGEKVVEETLVSHLLKSNCLITHQPDWGS
LQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLS
VYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ

Enzymatic activities

Reaction Substrate Type Position
preQ0base:preQ1base     None

Publications

Title Authors Journal Details PubMed Id DOI
From cyclohydrolase to oxidoreductase: discovery of nitrile reductase activity in a common fold. Van Lanen SG, Reader JS, Swairjo MA, de Crecy-Lagard V, Lee B, Iwata-Reuyl D Proc Natl Acad Sci U S A [details] 15767583 -
Identification of four genes necessary for biosynthesis of the modified nucleoside queuosine. Reader JS, Metzgar D, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 14660578 -

Links

_EcoCyc_

Last modification of this entry: 2014-04-24 12:43:13.158053
Edited by a user: magda
Edited content: Changed position.