Protein Summary

Cet1 from Saccharomyces cerevisiae

Full name: RNA triphosphatase Cet1
Synonym: Polynucleotide 5'-triphosphatase, mRNA 5'-triphosphatase, Tpase
GI: 308153424
Orf: P1433
COG: COG4943
UniProt: O13297
Structures: | 1D8HA | 1D8HB | 1D8HC | 1D8IA | 1D8IB | 1D8IC |
Complex:
Enzyme type: triphosphatase/hydrolase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

mRNA capping enzyme. TPase. Hydrolyzes the 5'-triphosphate end of nascent pre-mRNA to a 5'-diphosphate. The role of Ceg1-Cet1 interaction is to allostericaly activate Cet1.

Protein sequence:

MSYTDNPPQTKRALSLDDLVNHDENEKVKLQKLSEAANGSRPFAENLESD
INQTETGQAAPIDNYKESTGHGSHSQKPKSRKSSNDDEETDTDDEMGASG
EINFDSEMDFDYDKQHRNLLSNGSPPMNDGSDANAKLEKPSDDSIHQNSK
SDEEQRIPKQGNEGNIASNYITQVPLQKQKQTEKKIAGNAVGSVVKKEEE
ANAAVDNIFEEKATLQSKKNNIKRDLEVLNEISASSKPSKYKNVPIWAQK
WKPTIKALQSINVKDLKIDPSFLNIIPDDDLTKSVQDWVYATIYSIAPEL
RSFIELEMKFGVIIDAKGPDRVNPPVSSQCVFTELDAHLTPNIDASLFKE
LSKYIRGISEVTENTGKFSIIESQTRDSVYRVGLSTQRPRFLRMSTDIKT
GRVGQFIEKRHVAQLLLYSPKDSYDVKISLNLELPVPDNDPPEKYKSQSP
ISERTKDRVSYIHNDSCTRIDITKVENHNQNSKSRQSETTHEVELEINTP
ALLNAFDNITNDSKEYASLIRTFLNNGTIIRRKLSSLSYEIFEGSKKVM

Enzymatic activities

Reaction Substrate Type Position
pp(pN):p(pN) mRNA (m) 0

Publications

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of the yeast mRNA capping enzyme beta subunit gene encoding RNA 5'-triphosphatase, which is essential for cell viability. Tsukamoto T, Shibagaki Y, Imajoh-Ohmi S, Murakoshi T, Suzuki M, Nakamura A, Gotoh H, Mizumoto K Biochem Biophys Res Commun [details] 9345280 -
Structure and mechanism of yeast RNA triphosphatase: an essential component of the mRNA capping apparatus. Lima CD, Wang LK, Shuman S Cell [details] 10589681 -
Structure of the Saccharomyces cerevisiae Cet1-Ceg1 mRNA capping apparatus. Gu M, Rajashankar KR, Lima CD Structure [details] 20159466 -
The essential interaction between yeast mRNA capping enzyme subunits is not required for triphosphatase function in vivo. Takase Y, Takagi T, Komarnitsky PB, Buratowski S Mol Cell Biol [details] 11094081 -
An essential function of Saccharomyces cerevisiae RNA triphosphatase Cet1 is to stabilize RNA guanylyltransferase Ceg1 against thermal inactivation. Hausmann S, Ho CK, Schwer B, Shuman S... J Biol Chem [details] 11463793 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2013-02-14 17:53:20.014804
Edited by a user: magda
Edited content: Changed comments.