Protein Summary

Dus2 from Saccharomyces cerevisiae

Full name: tRNA-dihydrouridine synthase 2
Synonym: Smm1p
GI: 1730664
Orf: YNR015W
COG: COG0042
UniProt: P53720
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:20 - D

Comments:

Dus2 catalyzes the D formation of tRNA through reduction of uracil base with flavin mononucleotide (FMN) as a cofactor. The enzyme is reduced by NADPH. Other RNA modifications in tRNA substrate are required for rapid uracil reduction, indicating that dihydrouridine formation is a later step in tRNA maturation. Dihydrouridine of modified tRNA was also oxidized to uridine showing the reaction to be reversible. Dus 2 is a not essential enzyme.

Protein sequence:

MVTYAGKLVLAPMVRAGELPTRLMALAHGADLVWSPEIIDKKLIQCVRKE
NTALQTVDYVVPSKVQTRPETLVFRTYPKLESSKLIFQIGSASPALATQA
ALKVINDVSGIDINAGCPKHFSIHSGMGSALLRTPDTLCLILKELVKNVG
NPHSKPISVKIRLLDTKQDTLQLVKRLCATGITNLTVHCRKTEMRNREQP
ITDYIAEIYEICQANNVSLIVNGAIRDRSHFHDLQANHWKNTNIGGMIAE
CAERDPTVFDHTSKPSEDGPSWVVACREFIQWATKFDNHIGNTKYMLSRI
VPGKSVFFQYFARCKSPEEVSFVLKQLNDDGSAQTDPSEYLENCRAQEKA
LKNANAIAKQKRKQTDHIGSDTKKQKVVPLPTDI

Enzymatic activities

Reaction Substrate Type Position
U:D tRNA (t) Ala/IGC/prokaryotic cytosol 20
U:D tRNA (t) Arg/ICG/prokaryotic cytosol 20
U:D tRNA (t) Asn/GUU/prokaryotic cytosol 20
U:D tRNA (t) Asp/GUC/prokaryotic cytosol 20
U:D tRNA (t) Cys/GCA/prokaryotic cytosol 20
U:D tRNA (t) Gly/GCC/prokaryotic cytosol 20
U:D tRNA (t) Gly/{CC/prokaryotic cytosol 20
U:D tRNA (t) His/GUG/prokaryotic cytosol 20
U:D tRNA (t) Ile/IAU/prokaryotic cytosol 20
U:D tRNA (t) Ile/UAU/prokaryotic cytosol 20
U:D tRNA (t) Leu/UAG/prokaryotic cytosol 20
U:D tRNA (t) Leu/CAA/prokaryotic cytosol 20
U:D tRNA (t) Leu/UAA/prokaryotic cytosol 20
U:D tRNA (t) Pro/UGG/prokaryotic cytosol 20
U:D tRNA (t) Ser/CGA/prokaryotic cytosol 20
U:D tRNA (t) Ser/UGA/prokaryotic cytosol 20
U:D tRNA (t) Ser/IGA/prokaryotic cytosol 20
U:D tRNA (t) Thr/IGU/prokaryotic cytosol 20
U:D tRNA (t) Trp/CCA/prokaryotic cytosol 20
U:D tRNA (t) Tyr/GUA/prokaryotic cytosol 20
U:D tRNA (t) Val/UAC/prokaryotic cytosol 20
U:D tRNA (t) Val/IAC/prokaryotic cytosol 20

Publications

Title Authors Journal Details PubMed Id DOI
A novel human tRNA-dihydrouridine synthase involved in pulmonary carcinogenesis. Kato T, Daigo Y, Hayama S, Ishikawa N, Yamabuki T, Ito T, Miyamoto M, Kondo S, Nakamura Y Cancer Res [details] 15994936 -
The specificities of four yeast dihydrouridine synthases for cytoplasmic tRNAs. Xing F, Hiley SL, Hughes TR, Phizicky EM J Biol Chem [details] 14970222 -
A conserved family of Saccharomyces cerevisiae synthases effects dihydrouridine modification of tRNA. Xing F, Martzen MR, Phizicky EM RNA [details] 12003496 -
Mechanism of dihydrouridine synthase 2 from yeast and the importance of modifications for efficient tRNA reduction. Rider LW, Ottosen MB, Gattis SG, Palfey BA... J Biol Chem [details] 19139092 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2012-08-31 15:20:31.227641
Edited by a user: magda
Edited content: Changed additional_information, comments and papers.