Protein Summary

Cbf5 from Saccharomyces cerevisiae

Full name: H/ACA ribonucleoprotein complex subunit 4
Synonym: dyskerine
GI: 461698
Orf: YLR175W
COG: COG0130
UniProt: P33322
Structures: | 3UAI | 3U28 |
Complex: H/ACA RNP
Enzyme type: pseudouridine synthase
Position of modification - modification: t:many - Y
s:many - Y
l:many - Y
n:many - Y

Comments:

Eukaryal Cbf5 is the catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNPs) complex. Catalyzes the pseudouridylation of rRNA (including 5S and 5.8S rRNA) and small RNAs (snRNAs, snoRNAs). Contains one PUA domain. Works with 3 other subunits Gar1p, Nop10p, Nhp2p. A fifth protein (Shq1) is required for H/ACA RNP biogenenesis. In Eukarya, H/ACA RNPs are essential for three fundamental cellular processes: protein synthesis, mRNA splicing, and maintenance of genome integrity. For detailed information on modified positions see the snoRNA table ( http://modomics.genesilico.pl/snorna/ ).

Protein sequence:

MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLK
RDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTG
CLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGAL
FQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLC
VHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQWVYDNTRDES
YLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELY
DEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRW
GLGPVAQKKKQMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQ
ETKETEEEPKKAKEDSLIKEVETEKEEVKEDDSKKEKKEKKDKKEKKEKK
EKKDKKEKKEKKEKKRKSEDGDSEEKKSKKSKK

Enzymatic activities

Reaction Substrate Type Position
U:Y rRNA (r) SSU/18S/cytosolic many
U:Y rRNA (r) LSU-L/25S/cytosolic many
U:Y pre-rRNA (pre-r) all/35S/prokaryotic cytosol many
U:Y snRNA (sn) all/all/cytosolic many

Publications

Title Authors Journal Details PubMed Id DOI
An essential yeast protein, CBF5p, binds in vitro to centromeres and microtubules. Jiang W, Middleton K, Yoon HJ, Fouquet C, Carbon J Mol Cell Biol [details] 8336724 -
The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T, Reichow SL, Varani G, Ferre-D'Amare AR Nat Struct Mol Biol [details] 16286935 -
Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita. Rashid R, Liang B, Baker DL, Youssef OA, He Y, Phipps K, Terns RM, Terns MP, Li H Mol Cell [details] 16427014 -
The box H + ACA snoRNAs carry Cbf5p, the putative rRNA pseudouridine synthase. Lafontaine DL, Bousquet-Antonelli C, Henry Y, Caizergues-Ferrer M, Tollervey D Genes Dev [details] 9472021 -
Point mutations in yeast CBF5 can abolish in vivo pseudouridylation of rRNA. Zebarjadian Y, King T, Fournier MJ, Clarke L, Carbon J Mol Cell Biol [details] 10523634 -
Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. Li S, Duan J, Li D, Ma S, Ye K EMBO J [details] 22117216 -
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs. Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M RNA [details] 15388873 -
The box H/ACA RNP assembly factor Naf1p contains a domain homologous to Gar1p mediating its interaction with Cbf5p. Leulliot N, Godin KS, Hoareau-Aveilla C, Quevillon-Cheruel S, Varani G, Henry Y, Van Tilbeurgh H... J Mol Biol [details] 17612558 -

Links

_The yeast snoRNA database_
_Wikipedia - Pseudouridylate synthase_
_PubMed_
_Wikipedia - Small nucleolar RNA_
_SGD_

Last modification of this entry: 2013-12-18 11:41:26.421930
Edited by a user: magda
Edited content: Changed papers.