Protein Summary

TYW1 from Saccharomyces cerevisiae

Full name: tRNA wybutosine-synthesizing protein 1
Synonym:
GI: 2501612
Orf: YPL207W
COG: COG0731
UniProt: Q08960
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - yW

Comments:

An Fe-S cluster protein, *may* catalyze tricyclic formation of yW using Ado-Met and FMN as cofactors. Radical SAM enzyme.

Protein sequence:

MDGFRVAGALVVGALTAAYLYFGGRFSIALVIIVGYGIYCNEASGGSQDS
QEKLDLNKQQKKPCCSDKKIADGGKKTGGCCSDKKNGGGKGGGCCSSKGG
KKGGCCSSKGGKKGGCCSSKKNIGDNENTATEVEKAVNYPVTVDFTEVFR
KPTKKRSSTPKVFSKNSSSNSRVGKKLSVSKKIGPDGLIKSALTISNETL
LSSQIYVLYSSLQGAASKAAKSVYDKLKELDELTNEPKLLNLDDLSDFDD
YFINVPVENALYVLVLPSYDIDCPLDYFLQTLEENANDFRVDSFPLRKLV
GYTVLGLGDSESWPEKFCYQAKRADHWISRLGGRRIFPLGKVCMKTGGSA
KIDEWTSLLAETLKDDEPIIYEYDENADSEEDEEEGNGSDELGDVEDIGG
KGSNGKFSGADEIKQMVAKDSPTYKNLTKQGYKVIGSHSGVKICRWTKNE
LRGKGSCYKKSLFNIASSRCMELTPSLACSSKCVFCWRHGTNPVSKNWRW
EVDEPEYILENALKGHYSMIKQMRGVPGVIAERFAKAFEVRHCALSLVGE
PILYPHINKFIQLLHQKGITSFLVCNAQHPEALRNIVKVTQLYVSIDAPT
KTELKKVDRPLYKDFWERMVECLEILKTVQNHQRTVFRLTLVKGFNMGDV
SAYADLVQRGLPGFIEVKGATFSGSSDGNGNPLTMQNIPFYEECVKFVKA
FTTELQRRGLHYDLAAEHAHSNCLLIADTKFKINGEWHTHIDFDKFFVLL
NSGKDFTYMDYLEKTPEWALFGNGGFAPGNTRVYRKDKKKQNKENQETTT
RETPLPPIPA

Enzymatic activities

Reaction Substrate Type Position
m1G:imG-14 tRNA (t)   37

Publications

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA. Noma A, Kirino Y, Ikeuchi Y, Suzuki T EMBO J [details] 16642040 -
Discovery of a gene family critical to wyosine base formation in a subset of phenylalanine-specific transfer RNAs. Waas WF, de Crecy-Lagard V, Schimmel P J Biol Chem [details] 16162496 -
Radical mediated ring formation in the biosynthesis of the hypermodified tRNA base wybutosine. Young AP, Bandarian V... Curr Opin Chem Biol [details] 23856057 -

Links

_PubMed_
_SGD_

Last modification of this entry: 2014-05-20 10:44:36.212792
Edited by a user: magda
Edited content: Changed papers.