Protein Summary

TYW4 from Saccharomyces cerevisiae

Full name: Leucine carboxyl methyltransferase 2
Synonym: PPM2, LCMT2
GI: 1420038
Orf: YOL141W
COG:
UniProt: Q08282
Structures: | 2ZW9 | 2ZWA | 2ZZK |
Complex:
Enzyme type: methyltransferase, carboxymethyltransferase
Position of modification - modification: t:37 - yW

Comments:

TYW4 is a Ado-Met-dependent carboxymethyltransferase. It catalyzes two reactions: methylation of the α-carboxy group of yW-72 to form yW-58 and methoxycarbonylation of α-amino group of yW-58 to complete yW. It is proposed that these two reactions are performed with a single catalytic site. The methoxycarbonylation reaction may proceed through carbamate formation with CO2 and methylation with SAM, which results in CO2 fixation

Protein sequence:

MKNLTTIKQTNKNVKQERRKKYADLAIQGTNNSSIASKRSVELLYLPKLS
SANNFQMDKNNKLLEYFKFFVPKKIKRSPCINRGYWLRLFAIRSRLNSII
EQTPQDKKIVVVNLGCGYDPLPFQLLDTNNIQSQQYHDRVSFIDIDYSDL
LKIKIELIKTIPELSKIIGLSEDKDYVDDSNVDFLTTPKYLARPCDLNDS
KMFSTLLNECQLYDPNVVKVFVAEVSLAYMKPERSDSIIEATSKMENSHF
IILEQLIPKGPFEPFSKQMLAHFKRNDSPLQSVLKYNTIESQVQRFNKLG
FAYVNVGDMFQLWESADEATKKELLKVEPFDELEEFHLFCHHYVLCHATN
YKEFAFTQGFLFDRSISEINLTVDEDYQLLECECPINRKFGDVDVAGNDV
FYMGGSNPYRVNEILQMSIHYDKIDMKNIEVSSSEVPVARMCHTFTTISR
NNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMIKSLSHTRFRHSACSLPD
GNVLILGGVTEGPAMLLYNVTEEIFKDVTPKDEFFQNSLVSAGLEFDPVS
KQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITVIKKLQHPLFQRYGS
QIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRRIWED
HSLMLAGFSLVSTSMGTIHIIGGGATCYGFGSVTNVGLKLIAIAK

Enzymatic activities

Reaction Substrate Type Position
yW-58:yW tRNA (t) Phe/#AA/cytosolic 37
yW-72:yW-58 tRNA (t) Phe/#AA/cytosolic 37
yW-72:yW-58 tRNA (t) Phe/#AA/cytosolic 37
yW-58:yW tRNA (t) Phe/#AA/cytosolic 37

Publications

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA. Noma A, Kirino Y, Ikeuchi Y, Suzuki T EMBO J [details] 16642040 -
Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4. Suzuki Y, Noma A, Suzuki T, Ishitani R, Nureki O Nucleic Acids Res [details] 19287006 -

Links

_SGD_

Last modification of this entry: 2012-10-05 13:25:37.676717
Edited by a user: magda
Edited content: Changed enzyme_type.