Protein Summary

RmtB from Escherichia coli

Full name: 16S rRNA methyltransferase RmtB
Synonym:
GI: 410610030
Orf:
COG:
UniProt: Q763K9
Structures: | 3FRI | 3FRH | 3B89 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1405(1405) - m7G

Comments:

not present in E.coli K12, only in antibiotic-resistant clinical strains

Protein sequence:

MNINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLH
GICGAYVTPESLKAAAAALSAGDVKKALSLHASTKERLAELDTLYDFIFS
AETPRRVLDIACGLNPLALYERGIASVWGCDIHQGLGDVITPFAREKDWD
FTFALQDVLCAPPAEAGDLALIFKLLPLLEREQAGSAMALLQSLNTPRMA
VSFPTRSLGGRGKGMEANYAAWFEGGLPAEFEIEDKKTIGTELIYLIKKN
G

Enzymatic activities

Reaction Substrate Type Position
G:m7G rRNA (r) SSU/16S/prokaryotic cytosol 1405

Publications

Title Authors Journal Details PubMed Id DOI
Sequence analysis and structure prediction of aminoglycoside-resistance 16S rRNA:m7G methyltransferases. Bujnicki JM, Rychlewski L Acta Microbiol Pol [details] 11518396 -
Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases. Schmitt E, Galimand M, Panvert M, Courvalin P, Mechulam Y J Mol Biol [details] 19303884 -

Last modification of this entry: 2012-07-04 12:42:40.487708
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.