Protein Summary

ErmBC from Escherichia coli

Full name: rRNA adenine N-6-methyltransferase
Synonym:
GI: 127199
Orf:
COG: COG0030
UniProt: P10738
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2058(2058) - m6A

Comments:

ErmBC methylates the exocyclic amine of A2058 in Peptidyl Center (between helix 73 and 74) of 23S rRNA. It is responsible for the development of bacterial resistance to lincosamide/ Streptogramin-type of antibiotics. This enzyme arosed in E. coli by lateral gene transfer from a gram positive bacteria.

Protein sequence:

MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKI
SKQVTSIELDSHLFNLSSEKLKSNTRVTLIHQDILQFQFPNKQRYKIVGN
IPYHLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVS
IQQLLKLPAECFHPKPRVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNR
EYRQLFTKNQFHQAMKHAKVNNLSTVTYEQVLSIFNSYLLFNGRK

Enzymatic activities

Reaction Substrate Type Position
A:m6A rRNA (r) LSU/23S/prokaryotic cytosol 2058

Publications

Title Authors Journal Details PubMed Id DOI
Evidence for natural gene transfer from gram-positive cocci to Escherichia coli. Brisson-Noel A, Arthur M, Courvalin P J Bacteriol [details] 2832378 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2012-08-31 16:31:20.266740
Edited by a user: magda
Edited content: Changed additional_information and comments.